General Information

  • ID:  hor004373
  • Uniprot ID:  P25421
  • Protein name:  Neuropeptide gamma
  • Gene name:  NA
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  Expression is induced in the hypothalamus and olfactory bulb after feeding. |Expressed in the brain throughout development, with expression first observable in the nascent diencephalon, olfactory bulbs and hypothalamus shortly after fertilization. |Expres
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  SPANAQITRKRHKINSFVGLM
  • Length:  21(71-91)
  • Propeptide:  MKFLLPSIVIFLVLCQVFGEELGPKEDLDYWTGSNQVQDEWLQADPFREIIRRMTRKPRPHQFIGLMGKRSPANAQITRKRHKINSFVGLMGKRSQEEPESYEWGTVQIYDKRR
  • Signal peptide:  MKFLLPSIVIFLVLCQVFG
  • Modification:  T21 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P25421-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004373_AF2.pdbhor004373_ESM.pdb

Physical Information

Mass: 272570 Formula: C103H174N34O28S
Absent amino acids: CDEWY Common amino acids: AIKNRS
pI: 12.53 Basic residues: 5
Polar residues: 6 Hydrophobic residues: 7
Hydrophobicity: -45.24 Boman Index: -4510
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 79.05
Instability Index: 6707.62 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2002352
  • Title:  Carassin: a tachykinin that is structurally related to neuropeptide-gamma from the brain of the goldfish.